NBP255292PE
Novus Biologicals™ STK35 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255292PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255292PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
140901
Common Name
STK35 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/thr
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
STK35
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51123. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK35
- Source: E.coli Amino Acid Sequence: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF The STK35 Recombinant Protein Antigen is derived from E
- coli
- The STK35 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 140901
Common Name: STK35 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/thr
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: STK35
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51123. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
140901
Common Name:
STK35 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
bA550O8.2, CLIK-1, CLIK1Serine/threonine-protein kinase 35 L1, CLP-36 interacting kinase, CLP-36-interacting kinase 1, EC 2.7.11, EC 2.7.11.1, PDIK1, PDLIM1-interacting kinase 1, serine threonine kinase 35 long form, serine/threonine kinase 35, serine/thr
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
STK35
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51123. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7311
Common Name: UBA52 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: CEP52ubiquitin carboxyl extension protein 52, HUBCEP52, MGC126879, MGC126881, MGC57125, RPL40, UBCEP2, ubiquitin A-52 residue ribosomal protein fusion product 160S ribosomal protein L40, ubiquitin-52 amino acid fusion protein, ubiquitin-60S ribosomal prot
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: UBA52
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52114. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7311
Common Name:
UBA52 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
CEP52ubiquitin carboxyl extension protein 52, HUBCEP52, MGC126879, MGC126881, MGC57125, RPL40, UBCEP2, ubiquitin A-52 residue ribosomal protein fusion product 160S ribosomal protein L40, ubiquitin-52 amino acid fusion protein, ubiquitin-60S ribosomal prot
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
UBA52
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52114. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 389524
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: GTF2I Repeat Domain Containing 2B, GTF2I Repeat Domain-Containing Protein 2B, Transcription Factor GTF2IRD2-Beta
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
389524
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
GTF2I Repeat Domain Containing 2B, GTF2I Repeat Domain-Containing Protein 2B, Transcription Factor GTF2IRD2-Beta
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 389524
Common Name: GTF2IRD2B Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: GTF2I Repeat Domain Containing 2B, GTF2I Repeat Domain-Containing Protein 2B, Transcription Factor GTF2IRD2-Beta
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GTF2IRD2B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50966. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
389524
Common Name:
GTF2IRD2B Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
GTF2I Repeat Domain Containing 2B, GTF2I Repeat Domain-Containing Protein 2B, Transcription Factor GTF2IRD2-Beta
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GTF2IRD2B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50966. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml