NBP255310PE
Novus Biologicals™ PILR-alpha Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255310PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255310PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
29992
Common Name
PILR-alpha Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-li
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PILRA
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52080. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PILR-alpha
- Source: E.coli Amino Acid Sequence: ALSSSTSPRAPPSHRPLKSPQNETLYSVLK The PILR-alpha Recombinant Protein Antigen is derived from E
- coli
- The PILR-alpha Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 29992
Common Name: PILR-alpha Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-li
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PILRA
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52080. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
29992
Common Name:
PILR-alpha Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-li
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PILRA
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52080. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 80263
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
80263
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 80263
Common Name: TRIM45 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TRIM45
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51910. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
80263
Common Name:
TRIM45 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
RING finger protein 99, RNF99FLJ13181, tripartite motif containing 45, tripartite motif-containing 45, tripartite motif-containing protein 45
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TRIM45
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51910. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 22874
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0969MGC176733, PEPP-3, PEPP3Phosphoinositol 3-phosphate-binding protein 3, PH domain-containing family A member 6, phosphoinositol 3-phosphate-binding protein-3, pleckstrin homology domain containing, family A member 6, pleckstrin homology domain-containing family A member 6
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
22874
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
KIAA0969MGC176733, PEPP-3, PEPP3Phosphoinositol 3-phosphate-binding protein 3, PH domain-containing family A member 6, phosphoinositol 3-phosphate-binding protein-3, pleckstrin homology domain containing, family A member 6, pleckstrin homology domain-containing family A member 6
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__