NBP255314PE
Novus Biologicals™ Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255314PE-Each-of-1 | In Stock | ₹ 29,004.84 |
NBP255314PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 29,004.84
GST (18%): ₹ 5,220.871
Total Price: ₹ 34,225.711
Gene ID (Entrez)
4017
Common Name
Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LOXL2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51290. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysyl Oxidase Homolog 2/LOXL2
- Source: E.coli Amino Acid Sequence: CKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQI The Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen is derived from E
- coli
- The Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4017
Common Name: Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LOXL2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51290. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4017
Common Name:
Lysyl Oxidase Homolog 2/LOXL2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
EC 1.4.3, EC 1.4.3.-, LOR2, lysyl oxidase homolog 2, lysyl oxidase related 2, lysyl oxidase-like 2, Lysyl oxidase-like protein 2, Lysyl oxidase-related protein 2, Lysyl oxidase-related protein WS9-14, WS9-14
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LOXL2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51290. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7267
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DCRR1tetratricopeptide repeat protein 3 (TPR repeat protein D)10RNF105DKFZp686M0150, E3 ubiquitin-protein ligase TTC3, EC 6.3.2.-, Protein DCRR1, RING finger protein 105, tetratricopeptide repeat domain 3, Tetratricopeptide repeat protein 3, TPR repeat protein 3, TPR repeat protein D, TPRDI, TPRDII, TPRDTPRDIII
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7267
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DCRR1tetratricopeptide repeat protein 3 (TPR repeat protein D)10RNF105DKFZp686M0150, E3 ubiquitin-protein ligase TTC3, EC 6.3.2.-, Protein DCRR1, RING finger protein 105, tetratricopeptide repeat domain 3, Tetratricopeptide repeat protein 3, TPR repeat protein 3, TPR repeat protein D, TPRDI, TPRDII, TPRDTPRDIII
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4435
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: cbp/p300-interacting transactivator 1, Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1, melanocyte-specific gene 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4435
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
cbp/p300-interacting transactivator 1, Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1, melanocyte-specific gene 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4435
Common Name: CITED1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: cbp/p300-interacting transactivator 1, Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1, melanocyte-specific gene 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CITED1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51603. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4435
Common Name:
CITED1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
cbp/p300-interacting transactivator 1, Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1, melanocyte-specific gene 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
−20°C, avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CITED1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51603. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml