Novus Biologicals™ AP-2 gamma Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255343PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255343PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
7022
Common Name
AP-2 gamma Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Activating enhancer-binding protein 2 gamma, AP2-GAMMA, ERF1, estrogen receptor factor 1, hAP-2g, TFAP2G, transcription factor AP-2 gamma, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma), transcription factor AP-2 gamma (acti
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
−20°C, avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TFAP2C
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52143. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AP-2 gamma
- Source: E.coli Amino Acid Sequence: NYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK The AP-2 gamma Recombinant Protein Antigen is derived from E
- coli
- The AP-2 gamma Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7022
Common Name: AP-2 gamma Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Activating enhancer-binding protein 2 gamma, AP2-GAMMA, ERF1, estrogen receptor factor 1, hAP-2g, TFAP2G, transcription factor AP-2 gamma, transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma), transcription factor AP-2 gamma (acti
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TFAP2C
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52143. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 92014
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CG7943, FLJ37273, MGC14836, mitochondrial carrier triple repeat 1, mitochondrial carrier triple repeat protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 2745
Common Name: Glutaredoxin 1/GLRX1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: glutaredoxin (thioltransferase), glutaredoxin-1, GRXGRX1, MGC117407, Thioltransferase-1, TTase-1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GLRX
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50089. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
