NBP255358PE
Novus Biologicals™ Septin-9 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255358PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255358PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10801
Common Name
Septin-9 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SEPT9
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50183. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Septin-9
- Source: E.coli Amino Acid Sequence: PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS The Septin-9 Recombinant Protein Antigen is derived from E
- coli
- The Septin-9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10801
Common Name: Septin-9 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SEPT9
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50183. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10801
Common Name:
Septin-9 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SEPT9
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50183. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 22894
Common Name: DIS3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: 2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DIS3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52298. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
22894
Common Name:
DIS3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
−20°C, avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DIS3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52298. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10078
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: protein TSSC4, tumor suppressing subtransferable candidate 4, Tumor-suppressing STF cDNA 4 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10078
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
protein TSSC4, tumor suppressing subtransferable candidate 4, Tumor-suppressing STF cDNA 4 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10078
Common Name: TSSC4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: protein TSSC4, tumor suppressing subtransferable candidate 4, Tumor-suppressing STF cDNA 4 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TSSC4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52299. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10078
Common Name:
TSSC4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
protein TSSC4, tumor suppressing subtransferable candidate 4, Tumor-suppressing STF cDNA 4 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 4 protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TSSC4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52299. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml