NBP255369PE
Novus Biologicals™ S100A3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255369PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255369PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6274
Common Name
S100A3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
Protein S-100E, S100 calcium binding protein A3, S100 calcium-binding protein A3S100Eprotein S100-A3
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
S100A3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52081. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S100A3
- Source: E.coli Amino Acid Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK The S100A3 Recombinant Protein Antigen is derived from E
- coli
- The S100A3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6274
Common Name: S100A3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: Protein S-100E, S100 calcium binding protein A3, S100 calcium-binding protein A3S100Eprotein S100-A3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: S100A3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52081. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6274
Common Name:
S100A3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
Protein S-100E, S100 calcium binding protein A3, S100 calcium-binding protein A3S100Eprotein S100-A3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
S100A3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52081. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 79672
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.1.-, FLJ12171, FN3KL, FN3K-related protein, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
79672
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.1.-, FLJ12171, FN3KL, FN3K-related protein, FN3K-RP, fructosamine 3 kinase related protein, Fructosamine-3-kinase-related protein, ketosamine-3-kinase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 63922
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
63922
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 63922
Common Name: CHTF18 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S.
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: −20°C, avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CHTF18
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52082. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
63922
Common Name:
CHTF18 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S.
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
−20°C, avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CHTF18
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52082. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml