NBP255449PE
Novus Biologicals™ Cyclophilin-E Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255449PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255449PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10450
Common Name
Cyclophilin-E Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Cyclophilin E, Cyclophilin-33, CyP-33, CYP33, EC 5.2.1.8, MGC111222, MGC3736, peptidyl-prolyl cis-trans isomerase E, peptidylprolyl isomerase E (cyclophilin E), PPIase E, Rotamase E
Label Type
Unlabeled
Quantity
100μL
Research Category
DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PPIE
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cyclophilin-E
- Source: E.coli Amino Acid Sequence: EGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGS The Cyclophilin-E Recombinant Protein Antigen is derived from E
- coli
- The Cyclophilin-E Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10450
Common Name: Cyclophilin-E Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Cyclophilin E, Cyclophilin-33, CyP-33, CYP33, EC 5.2.1.8, MGC111222, MGC3736, peptidyl-prolyl cis-trans isomerase E, peptidylprolyl isomerase E (cyclophilin E), PPIase E, Rotamase E
Label Type: Unlabeled
Quantity: 100μL
Research Category: DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PPIE
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
10450
Common Name:
Cyclophilin-E Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Cyclophilin E, Cyclophilin-33, CyP-33, CYP33, EC 5.2.1.8, MGC111222, MGC3736, peptidyl-prolyl cis-trans isomerase E, peptidylprolyl isomerase E (cyclophilin E), PPIase E, Rotamase E
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PPIE
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 79745
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CAP-GLY domain containing linker protein family, member 4, CAP-Gly domain-containing linker protein 4, FLJ21069, FLJ32705, restin-like 2, Restin-like protein 2, RSNL2
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
79745
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CAP-GLY domain containing linker protein family, member 4, CAP-Gly domain-containing linker protein 4, FLJ21069, FLJ32705, restin-like 2, Restin-like protein 2, RSNL2
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 5454
Common Name: POU3F2/OCT7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcriptio
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51524. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: POU3F2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
5454
Common Name:
POU3F2/OCT7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcriptio
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51524. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
POU3F2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 79023
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: MGC5585, nucleoporin 37kDa, nucleoporin Nup37, Nup107-160 subcomplex subunit Nup37, p37FLJ22618
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
79023
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
MGC5585, nucleoporin 37kDa, nucleoporin Nup37, Nup107-160 subcomplex subunit Nup37, p37FLJ22618
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__