NBP255496PE
Novus Biologicals™ ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
The price for this product is unavailable. Please request a quote
Gene ID (Entrez)
7903
Common Name
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2,
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ST8SIA4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50263. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4
- Source: E.coli Amino Acid Sequence: VQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen is derived from E
- coli
- The ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 7903
Common Name: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2,
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ST8SIA4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50263. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7903
Common Name:
ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ST8SIA4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50263. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 222962
Common Name: SLC29A4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ENT4PMAT, equilibrative nucleoside transporter 4, FLJ34923, hENT4, Plasma membrane monoamine transporter, solute carrier family 29 (nucleoside transporters), member 4, Solute carrier family 29 member 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC29A4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50232. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
222962
Common Name:
SLC29A4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ENT4PMAT, equilibrative nucleoside transporter 4, FLJ34923, hENT4, Plasma membrane monoamine transporter, solute carrier family 29 (nucleoside transporters), member 4, Solute carrier family 29 member 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC29A4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50232. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 654790
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: PCP4L1, PCP4-like protein 1, Purkinje cell protein 4 like protein 1, Purkinje cell protein 4-like protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
654790
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
PCP4L1, PCP4-like protein 1, Purkinje cell protein 4 like protein 1, Purkinje cell protein 4-like protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 654790
Common Name: IQM1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: PCP4L1, PCP4-like protein 1, Purkinje cell protein 4 like protein 1, Purkinje cell protein 4-like protein 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PCP4L1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51803. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
654790
Common Name:
IQM1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
PCP4L1, PCP4-like protein 1, Purkinje cell protein 4 like protein 1, Purkinje cell protein 4-like protein 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PCP4L1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51803. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml