NBP255507PE
Novus Biologicals™ TMEM85 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255507PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255507PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51234
Common Name
TMEM85 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Cell Proliferation-Inducing Gene 17 Protein, EMC4, ER Membrane Protein Complex Subunit 4, PIG17, Proliferation-Inducing Gene 17, TMEM85, Transmembrane Protein 85
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
EMC4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51125. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM85
- Source: E.coli Amino Acid Sequence: LVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPM The TMEM85 Recombinant Protein Antigen is derived from E
- coli
- The TMEM85 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51234
Common Name: TMEM85 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Cell Proliferation-Inducing Gene 17 Protein, EMC4, ER Membrane Protein Complex Subunit 4, PIG17, Proliferation-Inducing Gene 17, TMEM85, Transmembrane Protein 85
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EMC4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51125. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51234
Common Name:
TMEM85 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Cell Proliferation-Inducing Gene 17 Protein, EMC4, ER Membrane Protein Complex Subunit 4, PIG17, Proliferation-Inducing Gene 17, TMEM85, Transmembrane Protein 85
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EMC4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51125. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 353288
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CK26, CK-26, cytokeratin-26, K25B, K25IRS2, K26, Keratin 25B, Keratin, Type I Cytoskeletal 26, keratin-25B, Keratin-26, KRT25B, KRT26, Type I Inner Root Sheath Specific Keratin 25 Irs2, Type I Inner Root Sheath-Specific Keratin-K25irs2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
353288
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CK26, CK-26, cytokeratin-26, K25B, K25IRS2, K26, Keratin 25B, Keratin, Type I Cytoskeletal 26, keratin-25B, Keratin-26, KRT25B, KRT26, Type I Inner Root Sheath Specific Keratin 25 Irs2, Type I Inner Root Sheath-Specific Keratin-K25irs2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 353288
Common Name: Cytokeratin 26 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CK26, CK-26, cytokeratin-26, K25B, K25IRS2, K26, Keratin 25B, Keratin, Type I Cytoskeletal 26, keratin-25B, Keratin-26, KRT25B, KRT26, Type I Inner Root Sheath Specific Keratin 25 Irs2, Type I Inner Root Sheath-Specific Keratin-K25irs2
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KRT26
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51126. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
353288
Common Name:
Cytokeratin 26 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CK26, CK-26, cytokeratin-26, K25B, K25IRS2, K26, Keratin 25B, Keratin, Type I Cytoskeletal 26, keratin-25B, Keratin-26, KRT25B, KRT26, Type I Inner Root Sheath Specific Keratin 25 Irs2, Type I Inner Root Sheath-Specific Keratin-K25irs2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
KRT26
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51126. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3326
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: D6S182, Heat shock 84 kDa, heat shock 90kD protein 1, beta, heat shock 90kDa protein 1, beta, Heat Shock Protein 90 Alpha Family Class B Member 1, Heat Shock Protein 90 KDa, heat shock protein 90kDa alpha (cytosolic), class B member 1, Heat Shock Protein 90kDa Alpha Family Class B Member 1, heat shock protein HSP 90-beta, HSP 84, HSP 90, HSP84, HSP90B, HSP90-BETA, HSPC2, HSPCB
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3326
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
D6S182, Heat shock 84 kDa, heat shock 90kD protein 1, beta, heat shock 90kDa protein 1, beta, Heat Shock Protein 90 Alpha Family Class B Member 1, Heat Shock Protein 90 KDa, heat shock protein 90kDa alpha (cytosolic), class B member 1, Heat Shock Protein 90kDa Alpha Family Class B Member 1, heat shock protein HSP 90-beta, HSP 84, HSP 90, HSP84, HSP90B, HSP90-BETA, HSPC2, HSPCB
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__