NBP255518PE
Novus Biologicals™ WDR5 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255518PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255518PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
11091
Common Name
WDR5 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, SWD3, Set1c WD40 repeat protein, homolog, WD repeat domain 5, WD repeat-containing protein 5, WD-repeat protein 5
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
WDR5
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR5
- Source: E.coli Amino Acid Sequence: ATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSS The WDR5 Recombinant Protein Antigen is derived from E
- coli
- The WDR5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 11091
Common Name: WDR5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, SWD3, Set1c WD40 repeat protein, homolog, WD repeat domain 5, WD repeat-containing protein 5, WD-repeat protein 5
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: WDR5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
11091
Common Name:
WDR5 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BIG3, BIG-3, BMP2-induced 3-kb gene protein, SWD3, SWD3, Set1c WD40 repeat protein, homolog, WD repeat domain 5, WD repeat-containing protein 5, WD-repeat protein 5
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
WDR5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50102. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57106
Common Name: NAT14 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.3.1, EC 2.3.1.-, K562 cell-derived leucine-zipper-like protein 1, K562 cells-derived leucine zipper-like protein 1, KLP1K562 cells-derived leucine-zipper-like protein 1, N-acetyltransferase 14, N-acetyltransferase 14 (GCN5-related, putative)
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NAT14
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51525. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57106
Common Name:
NAT14 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.3.1, EC 2.3.1.-, K562 cell-derived leucine-zipper-like protein 1, K562 cells-derived leucine zipper-like protein 1, KLP1K562 cells-derived leucine-zipper-like protein 1, N-acetyltransferase 14, N-acetyltransferase 14 (GCN5-related, putative)
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NAT14
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51525. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3397
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding 1, inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3397
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding 1, inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 3397
Common Name: ID1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ID1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51721. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3397
Common Name:
ID1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ID1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51721. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml