NBP255640PE
Novus Biologicals™ EEF1E1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255640PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255640PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9521
Common Name
EEF1E1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Mul
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
EEF1E1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52199. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EEF1E1
- Source: E.coli Amino Acid Sequence: GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH The EEF1E1 Recombinant Protein Antigen is derived from E
- coli
- The EEF1E1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9521
Common Name: EEF1E1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Mul
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EEF1E1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52199. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9521
Common Name:
EEF1E1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
AIMP3Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3, ARS-interacting multifunctional protein 3, Elongation factor p18, eukaryotic translation elongation factor 1 epsilon 1, eukaryotic translation elongation factor 1 epsilon-1, Mul
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EEF1E1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52199. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3837
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: IMB1, Impnb, importin 1, importin 90, importin beta-1 subunit, importin subunit beta-1, importin-90, IPO1, IPOB, karyopherin (importin) beta 1, Karyopherin subunit beta-1, MGC2155, MGC2156, MGC2157, NTF97Pore targeting complex 97 kDa subunit, Nuclear factor p97, PTAC97
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3837
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
IMB1, Impnb, importin 1, importin 90, importin beta-1 subunit, importin subunit beta-1, importin-90, IPO1, IPOB, karyopherin (importin) beta 1, Karyopherin subunit beta-1, MGC2155, MGC2156, MGC2157, NTF97Pore targeting complex 97 kDa subunit, Nuclear factor p97, PTAC97
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 3837
Common Name: Importin beta/KPNB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: IMB1, Impnb, importin 1, importin 90, importin beta-1 subunit, importin subunit beta-1, importin-90, IPO1, IPOB, karyopherin (importin) beta 1, Karyopherin subunit beta-1, MGC2155, MGC2156, MGC2157, NTF97Pore targeting complex 97 kDa subunit, Nuclear fact
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: KPNB1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3837
Common Name:
Importin beta/KPNB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
IMB1, Impnb, importin 1, importin 90, importin beta-1 subunit, importin subunit beta-1, importin-90, IPO1, IPOB, karyopherin (importin) beta 1, Karyopherin subunit beta-1, MGC2155, MGC2156, MGC2157, NTF97Pore targeting complex 97 kDa subunit, Nuclear fact
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
KPNB1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57708
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp781G0451, Early response 1, ER1, hMI-ER1, KIAA1610MI-ER1, mesoderm induction early response 1 (MI-ER1), mesoderm induction early response 1 homolog (Xenopus laevis), mesoderm induction early response protein 1, MGC131940, MGC150640, MGC150641, Mi-er1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57708
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp781G0451, Early response 1, ER1, hMI-ER1, KIAA1610MI-ER1, mesoderm induction early response 1 (MI-ER1), mesoderm induction early response 1 homolog (Xenopus laevis), mesoderm induction early response protein 1, MGC131940, MGC150640, MGC150641, Mi-er1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__