NBP255743PE
Novus Biologicals™ PIGQ Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255743PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255743PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9091
Common Name
PIGQ Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthes
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PIGQ
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52484. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGQ
- Source: E.coli Amino Acid Sequence: YVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ The PIGQ Recombinant Protein Antigen is derived from E
- coli
- The PIGQ Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9091
Common Name: PIGQ Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthes
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PIGQ
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52484. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9091
Common Name:
PIGQ Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthes
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PIGQ
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52484. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3732
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CD82 antigenC33, CD82 molecule, IA4C33 antigen, Inducible membrane protein R2, KAI1GR15, kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4)), Metastasis suppressor Kangai-1, R2, SAR2tetraspanin-27, ST6tspan-27, Suppressor of tumorigenicity 6 protein, Tetraspanin-27, Tspan-27, TSPAN274F9
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3732
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CD82 antigenC33, CD82 molecule, IA4C33 antigen, Inducible membrane protein R2, KAI1GR15, kangai 1 (suppression of tumorigenicity 6, prostate; CD82 antigen (R2 leukocyteantigen, antigen detected by monoclonal and IA4)), Metastasis suppressor Kangai-1, R2, SAR2tetraspanin-27, ST6tspan-27, Suppressor of tumorigenicity 6 protein, Tetraspanin-27, Tspan-27, TSPAN274F9
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2259
Common Name: FGF14 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FGF14
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51638. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2259
Common Name:
FGF14 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
bA397O8.2, FGF-14, FHF4FHF-4, fibroblast growth factor 14, Fibroblast growth factor homologous factor 4, SCA27MGC119129
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FGF14
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51638. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6618
Common Name: SNAP45 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Sma
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SNAPC2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51639. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6618
Common Name:
SNAP45 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Proximal sequence element-binding transcription factor subunit delta, PSE-binding factor subunit delta, PTF subunit delta, PTFdelta, small nuclear RNA activating complex, polypeptide 2, 45kD, small nuclear RNA activating complex, polypeptide 2, 45kDa, Sma
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SNAPC2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51639. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml