NBP255778PE
Novus Biologicals™ POLR3G Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255778PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255778PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10622
Common Name
POLR3G Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DNA-directed RNA polymerase III 32 kDa polypeptide, DNA-directed RNA polymerase III subunit G, DNA-directed RNA polymerase III subunit RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD), RNA polymerase III 32 kDa subunit, RNA polymerase III su
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
POLR3G
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50228. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLR3G
- Source: E.coli Amino Acid Sequence: LALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWR The POLR3G Recombinant Protein Antigen is derived from E
- coli
- The POLR3G Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10622
Common Name: POLR3G Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DNA-directed RNA polymerase III 32 kDa polypeptide, DNA-directed RNA polymerase III subunit G, DNA-directed RNA polymerase III subunit RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD), RNA polymerase III 32 kDa subunit, RNA polymerase III su
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: POLR3G
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50228. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10622
Common Name:
POLR3G Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DNA-directed RNA polymerase III 32 kDa polypeptide, DNA-directed RNA polymerase III subunit G, DNA-directed RNA polymerase III subunit RPC7, polymerase (RNA) III (DNA directed) polypeptide G (32kD), RNA polymerase III 32 kDa subunit, RNA polymerase III su
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
POLR3G
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50228. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51315
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CHBP2, cryptogenic hepatitis binding protein, Cryptogenic hepatitis-binding protein 2, FLJ22333, lysine-rich coiled-coil 1, lysine-rich coiled-coil protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
51315
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CHBP2, cryptogenic hepatitis binding protein, Cryptogenic hepatitis-binding protein 2, FLJ22333, lysine-rich coiled-coil 1, lysine-rich coiled-coil protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4301
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AF64, afadin, FLJ34371, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4301
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AF64, afadin, FLJ34371, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4301
Common Name: Afadin/AF-6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AF64, afadin, FLJ34371, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MLLT4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4301
Common Name:
Afadin/AF-6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
AF64, afadin, FLJ34371, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MLLT4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml