NBP255790PE
Novus Biologicals™ ZNF721 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255790PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255790PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
170960
Common Name
ZNF721 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ZNF721 zinc finger protein 721
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ZNF721
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52867. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF721
- Source: E.coli Amino Acid Sequence: SSLISSCRVISHGLSRGRNRATEKNDLLTTEEPVVKHRFDLQYPEEMWRNTVVQKGR The ZNF721 Recombinant Protein Antigen is derived from E
- coli
- The ZNF721 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 170960
Common Name: ZNF721 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ZNF721 zinc finger protein 721
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZNF721
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52867. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
170960
Common Name:
ZNF721 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ZNF721 zinc finger protein 721
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ZNF721
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52867. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 26030
Common Name: PLEKHG3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ARHGEF43, KIAA0599, PH Domain-Containing Family G Member 3, Pleckstrin Homology And RhoGEF Domain Containing G3, Pleckstrin Homology Domain Containing, Family G, Member 3, Pleckstrin Homology Domain-Containing Family G Member 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PLEKHG3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
26030
Common Name:
PLEKHG3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ARHGEF43, KIAA0599, PH Domain-Containing Family G Member 3, Pleckstrin Homology And RhoGEF Domain Containing G3, Pleckstrin Homology Domain Containing, Family G, Member 3, Pleckstrin Homology Domain-Containing Family G Member 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PLEKHG3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5717
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: MGC3844,26S proteasome regulatory subunit RPN6, p44.5,26S proteasome regulatory subunit 9, proteasome (prosome, macropain) 26S subunit, non-ATPase, 11,26S proteasome regulatory subunit p44.5, Rpn6,26S proteasome regulatory subunit S9, S9,26S proteasome non-ATPase regulatory subunit 11
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5717
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
MGC3844,26S proteasome regulatory subunit RPN6, p44.5,26S proteasome regulatory subunit 9, proteasome (prosome, macropain) 26S subunit, non-ATPase, 11,26S proteasome regulatory subunit p44.5, Rpn6,26S proteasome regulatory subunit S9, S9,26S proteasome non-ATPase regulatory subunit 11
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 11108
Common Name: PRDM4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: MGC45046, PFM1PR domain-containing protein 4, PR domain containing 4, PR domain zinc finger protein 4, PR-domain zinc-finger protein PFM1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PRDM4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53024. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
11108
Common Name:
PRDM4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
MGC45046, PFM1PR domain-containing protein 4, PR domain containing 4, PR domain zinc finger protein 4, PR-domain zinc-finger protein PFM1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PRDM4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53024. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml