NBP255874PE
Novus Biologicals™ Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255874PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255874PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
51237
Common Name
Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proa
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MZB1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50229. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Proapoptotic Caspase Adaptor Protein
- Source: E.coli Amino Acid Sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS The Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen is derived from E
- coli
- The Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 51237
Common Name: Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proa
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MZB1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50229. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51237
Common Name:
Proapoptotic Caspase Adaptor Protein Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
caspase-2 binding protein, FLJ32987, HSPC190, marginal zone B and B1 cell-specific protein, MGC29506, PACAP, pERp1, plasma cell-induced ER protein 1, plasma cell-induced resident endoplasmic reticulum protein, Plasma cell-induced resident ER protein, Proa
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MZB1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50229. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4883
Common Name: Natriuretic Peptide Receptor C Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ANP-C, ANPR-C, ANPRCFLJ14054, Atrial natriuretic peptide clearance receptor, atrial natriuretic peptide receptor 3, Atrial natriuretic peptide receptor type C, C5orf23, chromosome 5 open reading frame 23, GUCY2B, natriuretic peptide receptor C/guanylate c
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NPR3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51796. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4883
Common Name:
Natriuretic Peptide Receptor C Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ANP-C, ANPR-C, ANPRCFLJ14054, Atrial natriuretic peptide clearance receptor, atrial natriuretic peptide receptor 3, Atrial natriuretic peptide receptor type C, C5orf23, chromosome 5 open reading frame 23, GUCY2B, natriuretic peptide receptor C/guanylate c
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NPR3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51796. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2553
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit beta-2, NRF2B1, NRF2B2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2553
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit beta-2, NRF2B1, NRF2B2, Nuclear respiratory factor 2, Transcription factor E4TF1-47, Transcription factor E4TF1-53
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2553
Common Name: GABPB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GABPB1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50741. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2553
Common Name:
GABPB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
E4TF1, E4TF1-47, E4TF1-53, E4TF1BBABPB2, GA binding protein transcription factor, beta subunit 1, GA binding protein transcription factor, beta subunit 2, GA-binding protein subunit beta-1, GABP subunit beta-1, GABPB-1, GABPB2, GABPB-2, GABPBGABP subunit
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GABPB1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50741. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml