NBP255882PE
Novus Biologicals™ SF3B4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255882PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255882PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10262
Common Name
SF3B4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Hsh49, pre-mRNA splicing factor SF3b 49 kDa subunit, Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49MGC10828, SF3B49, SF3b50, spliceosomal protein, spliceosome-associated protein (U2 snRNP), Spliceosome-associated protein 49, splicing factor 3
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SF3B4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50634. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SF3B4
- Source: E.coli Amino Acid Sequence: VSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNP The SF3B4 Recombinant Protein Antigen is derived from E
- coli
- The SF3B4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10262
Common Name: SF3B4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Hsh49, pre-mRNA splicing factor SF3b 49 kDa subunit, Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49MGC10828, SF3B49, SF3b50, spliceosomal protein, spliceosome-associated protein (U2 snRNP), Spliceosome-associated protein 49, splicing factor 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SF3B4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50634. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10262
Common Name:
SF3B4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Hsh49, pre-mRNA splicing factor SF3b 49 kDa subunit, Pre-mRNA-splicing factor SF3b 49 kDa subunit, SAP 49, SAP49MGC10828, SF3B49, SF3b50, spliceosomal protein, spliceosome-associated protein (U2 snRNP), Spliceosome-associated protein 49, splicing factor 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SF3B4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50634. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6301
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6301
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6301
Common Name: Seryl tRNA synthetase Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SARS
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50636. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6301
Common Name:
Seryl tRNA synthetase Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SARS
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50636. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 661
Common Name: POLR3D Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BN51, BN51 (BHK21) temperature sensitivity complementing, BN51TDNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, DNA-directed RNA polymerase III subunit RPC4, polymerase (RNA) III (DNA directed) polypeptide D,
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: POLR3D
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53136. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
661
Common Name:
POLR3D Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BN51, BN51 (BHK21) temperature sensitivity complementing, BN51TDNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, DNA-directed RNA polymerase III subunit RPC4, polymerase (RNA) III (DNA directed) polypeptide D,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
POLR3D
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53136. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml