NBP255898PE
Novus Biologicals™ U2AF1L4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255898PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255898PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
199746
Common Name
U2AF1L4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA a
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
U2AF1L4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52506. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human U2AF1L4
- Source: E.coli Amino Acid Sequence: PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP The U2AF1L4 Recombinant Protein Antigen is derived from E
- coli
- The U2AF1L4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 199746
Common Name: U2AF1L4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA a
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: U2AF1L4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52506. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
199746
Common Name:
U2AF1L4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA a
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
U2AF1L4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52506. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57823
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SLAM family member 7
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57823
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SLAM family member 7
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 57823
Common Name: CRACC/SLAMF7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SL
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLAMF7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50495. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
57823
Common Name:
CRACC/SLAMF7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SL
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLAMF7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50495. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 64318
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AD24NOC3-like protein, C10orf117, chromosome 10 open reading frame 117, Factor for adipocyte differentiation 24, FAD24NOC3 protein homolog, FLJ12820, nucleolar complex associated 3 homolog (S. cerevisiae), nucleolar complex protein 3 homolog, Nucleolar complex-associated protein 3-like protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
64318
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AD24NOC3-like protein, C10orf117, chromosome 10 open reading frame 117, Factor for adipocyte differentiation 24, FAD24NOC3 protein homolog, FLJ12820, nucleolar complex associated 3 homolog (S. cerevisiae), nucleolar complex protein 3 homolog, Nucleolar complex-associated protein 3-like protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__