NBP255915PE
Novus Biologicals™ Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255915PE-Each-of-1 | In Stock | ₹ 26,095.80 |
NBP255915PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 26,095.80
GST (18%): ₹ 4,697.244
Total Price: ₹ 30,793.044
Gene ID (Entrez)
4779
Common Name
Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NFE2L1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
Human
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nuclear Factor Erythroid 2 Related Factor 1
- Source: E.coli Amino Acid Sequence: FDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTALSL The Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen is derived from E
- coli
- The Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4779
Common Name: Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NFE2L1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: Human
Gene ID (Entrez):
4779
Common Name:
Nuclear Factor Erythroid 2 Related Factor 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ00380, HBZ17, LCR-F1, Locus control region-factor 1, NF-E2-related factor 1, NFE2-related factor 1, NRF1TCF11, nuclear factor (erythroid-derived 2)-like 1, nuclear factor erythroid 2-related factor 1, Nuclear factor, erythroid derived 2, like 1, TCF-11
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NFE2L1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
Human
Gene ID (Entrez): 84920
Common Name: ALG10 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ALG10A, alpha-1,2-glucosyltransferase ALG10-A, alpha-1,2-glucosyltransferase), alpha2-glucosyltransferase, Alpha-2-glucosyltransferase ALG10-A, asparagine-linked glycosylation 10 homolog (yeast, asparagine-linked glycosylation 10, alpha-1,2-glucosyltransf
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ALG10
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50984. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
84920
Common Name:
ALG10 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ALG10A, alpha-1,2-glucosyltransferase ALG10-A, alpha-1,2-glucosyltransferase), alpha2-glucosyltransferase, Alpha-2-glucosyltransferase ALG10-A, asparagine-linked glycosylation 10 homolog (yeast, asparagine-linked glycosylation 10, alpha-1,2-glucosyltransf
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ALG10
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50984. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 22873
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DAZ interacting protein 1, DAZ-interacting protein 1/2, DZIP, DZIP2, DZIPDAZ interacting protein testis1, DZIPt1, KIAA0996zinc finger DAZ interacting protein 1, RP11-23E3.3, zinc finger protein DZIP1, zinc-finger protein DZIPt1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
22873
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DAZ interacting protein 1, DAZ-interacting protein 1/2, DZIP, DZIP2, DZIPDAZ interacting protein testis1, DZIPt1, KIAA0996zinc finger DAZ interacting protein 1, RP11-23E3.3, zinc finger protein DZIP1, zinc-finger protein DZIPt1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 22873
Common Name: DZIP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DAZ interacting protein 1, DAZ-interacting protein 1/2, DZIP, DZIP2, DZIPDAZ interacting protein testis1, DZIPt1, KIAA0996zinc finger DAZ interacting protein 1, RP11-23E3.3, zinc finger protein DZIP1, zinc-finger protein DZIPt1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DZIP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53200. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
22873
Common Name:
DZIP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DAZ interacting protein 1, DAZ-interacting protein 1/2, DZIP, DZIP2, DZIPDAZ interacting protein testis1, DZIPt1, KIAA0996zinc finger DAZ interacting protein 1, RP11-23E3.3, zinc finger protein DZIP1, zinc-finger protein DZIPt1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DZIP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53200. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml