NBP255964PE
Novus Biologicals™ MRCK Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255964PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255964PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8476
Common Name
MRCK Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKAD
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CDC42BPA
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53278. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRCK
- Source: E.coli Amino Acid Sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD The MRCK Recombinant Protein Antigen is derived from E
- coli
- The MRCK Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8476
Common Name: MRCK Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKAD
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CDC42BPA
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53278. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8476
Common Name:
MRCK Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKAD
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CDC42BPA
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53278. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 389362
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: proteasome assembly chaperone 4, bA506K6.2, C6orf86, PAC4, proteasome (prosome, macropain) assembly chaperone 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
389362
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
proteasome assembly chaperone 4, bA506K6.2, C6orf86, PAC4, proteasome (prosome, macropain) assembly chaperone 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 389362
Common Name: PSMG4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: proteasome assembly chaperone 4, bA506K6.2, C6orf86, PAC4, proteasome (prosome, macropain) assembly chaperone 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PSMG4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
389362
Common Name:
PSMG4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
proteasome assembly chaperone 4, bA506K6.2, C6orf86, PAC4, proteasome (prosome, macropain) assembly chaperone 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PSMG4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53045. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 27199
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Alpha-ketoglutarate receptor 1, G protein-coupled receptor 80, G protein-coupled receptor 99, GPR802-oxoglutarate receptor 1, GPR99, G-protein coupled receptor 80, G-protein coupled receptor 99, MGC119206, MGC119207, MGC119208, oxoglutarate (alpha-ketoglutarate) receptor 1, P2RY15P2Y-like GPCR, P2Y purinoceptor 15, P2Y15P2Y-like nucleotide receptor, seven transmembrane helix receptor
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
27199
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Alpha-ketoglutarate receptor 1, G protein-coupled receptor 80, G protein-coupled receptor 99, GPR802-oxoglutarate receptor 1, GPR99, G-protein coupled receptor 80, G-protein coupled receptor 99, MGC119206, MGC119207, MGC119208, oxoglutarate (alpha-ketoglutarate) receptor 1, P2RY15P2Y-like GPCR, P2Y purinoceptor 15, P2Y15P2Y-like nucleotide receptor, seven transmembrane helix receptor
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__