NBP255978PE
Novus Biologicals™ PABPC1L Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP255978PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP255978PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
80336
Common Name
PABPC1L Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PABPC1L
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52959. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PABPC1L
- Source: E.coli Amino Acid Sequence: ILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQP The PABPC1L Recombinant Protein Antigen is derived from E
- coli
- The PABPC1L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 80336
Common Name: PABPC1L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PABPC1L
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52959. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
80336
Common Name:
PABPC1L Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C20orf119, Chromosome 20 Open Reading Frame 119, DJ1069P2.3, Embryonic Poly(A) Binding Protein, EPAB, PABPC1L1, Poly(A) Binding Protein Cytoplasmic 1 Like, Poly(A) Binding Protein, Cytoplasmic 1-Like, Polyadenylate-Binding Protein 1-Like
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PABPC1L
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52959. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10750
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10750
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 10750
Common Name: GRAP Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GRAP
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50992. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10750
Common Name:
GRAP Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
GRB2-related adapter protein, GRB2-related adaptor protein, growth factor receptor-bound protein 2-related adaptor protein, MGC64880
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GRAP
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50992. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 400961
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: KIAA1155, PABP-Interacting Protein 2B, PAIP-2B, Poly(A) Binding Protein Interacting Protein 2B, Poly(A)-Binding Protein-Interacting Protein 2B, Polyadenylate-Binding Protein-Interacting Protein 2B
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
400961
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
KIAA1155, PABP-Interacting Protein 2B, PAIP-2B, Poly(A) Binding Protein Interacting Protein 2B, Poly(A)-Binding Protein-Interacting Protein 2B, Polyadenylate-Binding Protein-Interacting Protein 2B
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__