NBP256058PE
Novus Biologicals™ SHC3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256058PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256058PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
53358
Common Name
SHC3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transform
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SHC3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53357. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SHC3
- Source: E.coli Amino Acid Sequence: LRFKQYLQCPTKIPALHDRMQSLDEPWTEEEGDGSD The SHC3 Recombinant Protein Antigen is derived from E
- coli
- The SHC3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 53358
Common Name: SHC3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transform
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SHC3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53357. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
53358
Common Name:
SHC3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Neuronal Shc, NSHCDKFZp686H1544, N-Shcsrc homology 2 domain containing transforming protein C3, Protein Rai, RAI, SH2 domain protein C3, SHC (Src homology 2 domain containing) transforming protein 3, SHCCFLJ45325, SHC-transforming protein 3, SHC-transform
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SHC3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53357. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 27231
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
27231
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside kinase 2, NmR-K 2, NRK2RNK 2, Ribosylnicotinamide kinase 2, Ribosylnicotinic acid kinase 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 27231
Common Name: ITGB1BP3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NMRK2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51958. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
27231
Common Name:
ITGB1BP3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.7.1.22, EC 2.7.1.n4, integrin beta 1 binding protein 3, Integrin beta-1-binding protein 3, MGC126624, MIBPNRK 2, Muscle integrin-binding protein, muscle-specific beta 1 integrin binding protein, nicotinamide riboside kinase 2, Nicotinic acid riboside
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NMRK2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51958. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8838
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CCN family member 6, CCN6MGC125988, LIBC, MGC125987, MGC125989, PPAC, PPD, WISP-3, WNT1 inducible signaling pathway protein 3, WNT1-inducible-signaling pathway protein 3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8838
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CCN family member 6, CCN6MGC125988, LIBC, MGC125987, MGC125989, PPAC, PPD, WISP-3, WNT1 inducible signaling pathway protein 3, WNT1-inducible-signaling pathway protein 3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__