NBP256178PE
Novus Biologicals™ n-Myc Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256178PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256178PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4613
Common Name
n-Myc Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian mye
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MYCN
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human n-Myc
- Source: E.coli Amino Acid Sequence: VEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAA The n-Myc Recombinant Protein Antigen is derived from E
- coli
- The n-Myc Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4613
Common Name: n-Myc Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian mye
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MYCN
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4613
Common Name:
n-Myc Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BHLHE37, bHLHe37N-myc proto-oncogene protein, Class E basic helix-loop-helix protein 37, MODED, neuroblastoma-derived v-myc avian myelocytomatosis viral related oncogene, N-myc, NMYCneuroblastoma MYC oncogene, ODED, oncogene NMYC, pp65/67, v-myc avian mye
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MYCN
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52175. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 126006
Common Name: PCP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp686M0187, FLJ27345, GPSM4, L7, MGC41903, Purkinje cell protein 2, Purkinje cell protein 2 homolog, Purkinje cell-specific protein L7
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PCP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52176. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
126006
Common Name:
PCP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DKFZp686M0187, FLJ27345, GPSM4, L7, MGC41903, Purkinje cell protein 2, Purkinje cell protein 2 homolog, Purkinje cell-specific protein L7
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PCP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52176. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6558
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Basolateral Na-K-Cl symporter, BSC, BSC2, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1, NKCC1MGC104233, solute carrier family 12 (sodium/potassium/chloride transporters), member 2, solute carrier family 12 member 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6558
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Basolateral Na-K-Cl symporter, BSC, BSC2, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1, NKCC1MGC104233, solute carrier family 12 (sodium/potassium/chloride transporters), member 2, solute carrier family 12 member 2
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6558
Common Name: NKCC1/SLC12A2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Basolateral Na-K-Cl symporter, BSC, BSC2, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1, NKCC1MGC104233, solute carrier family 12 (sodium/potassium/chloride transporters), member 2, solute carrier family 12 member 2
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC12A2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52716. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6558
Common Name:
NKCC1/SLC12A2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Basolateral Na-K-Cl symporter, BSC, BSC2, Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1, NKCC1MGC104233, solute carrier family 12 (sodium/potassium/chloride transporters), member 2, solute carrier family 12 member 2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC12A2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52716. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml