NBP256263PE
Novus Biologicals™ ZNF444 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256263PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256263PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
55311
Common Name
ZNF444 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
HZF3, MGC126498, zinc finger protein 268, zinc finger protein 3, Zinc finger protein HZF3
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ZNF444
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF444
- Source: E.coli Amino Acid Sequence: DSQAVRPYKQEPSSPPLAPGLPAFLAAPGTTSCPECGKTSLKPAHLLRHRQSHSGE The ZNF444 Recombinant Protein Antigen is derived from E
- coli
- The ZNF444 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 55311
Common Name: ZNF444 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: HZF3, MGC126498, zinc finger protein 268, zinc finger protein 3, Zinc finger protein HZF3
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZNF444
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
55311
Common Name:
ZNF444 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
HZF3, MGC126498, zinc finger protein 268, zinc finger protein 3, Zinc finger protein HZF3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ZNF444
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 27043
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
27043
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
HMX3, MNARmodulator of nongenomic activity of estrogen receptor, Modulator of non-genomic activity of estrogen receptor, P160, proline and glutamic acid rich nuclear protein, proline, glutamate and leucine rich protein 1, proline, glutamic acid and leucine rich protein 1, proline-, glutamic acid- and leucine-rich protein 1, proline-, glutamic acid-, leucine-rich protein 1, Transcription factor HMX3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 221662
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
221662
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 221662
Common Name: RBM24 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RBM24
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
221662
Common Name:
RBM24 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
dJ259A10.1, FLJ26355, FLJ30829, FLJ37697, RNA binding motif protein 24, RNA-binding motif protein 24, RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6, RNPC6
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RBM24
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml