NBP256267PE
Novus Biologicals™ SMARCD2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256267PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256267PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6603
Common Name
SMARCD2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SMARCD2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52391. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMARCD2
- Source: E.coli Amino Acid Sequence: RIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELR The SMARCD2 Recombinant Protein Antigen is derived from E
- coli
- The SMARCD2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6603
Common Name: SMARCD2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SMARCD2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52391. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6603
Common Name:
SMARCD2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SMARCD2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52391. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23509
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23509
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23509
Common Name: Protein O-Fucosyltransferase 1/POFUT1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: POFUT1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52392. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23509
Common Name:
Protein O-Fucosyltransferase 1/POFUT1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FUT12EC 2.4.1.221, GDP-fucose protein O-fucosyltransferase 1, KIAA0180MGC2482, o-fucosyltransferase protein, O-Fuc-T, O-FucT-1, O-FUT, Peptide-O-fucosyltransferase 1, protein O-fucosyltransferase 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
POFUT1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52392. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 390874
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
390874
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
OC3, OC-3, one cut domain family member 3, one cut domain, family member 3, one cut homeobox 3, transcription factor ONECUT-3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__