NBP256275PE
Novus Biologicals™ CCL19/MIP-3 beta Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256275PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256275PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
6363
Common Name
CCL19/MIP-3 beta Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage in
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CCL19
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL19/MIP-3 beta
- Source: E.coli Amino Acid Sequence: LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS The CCL19/MIP-3 beta Recombinant Protein Antigen is derived from E
- coli
- The CCL19/MIP-3 beta Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 6363
Common Name: CCL19/MIP-3 beta Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage in
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CCL19
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6363
Common Name:
CCL19/MIP-3 beta Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
beta chemokine exodus-3, Beta-chemokine exodus-3, CC chemokine ligand 19, C-C motif chemokine 19, chemokine (C-C motif) ligand 19, CKb11, EBI1-ligand chemokine, ELCMIP-3-beta, Epstein-Barr virus-induced molecule 1 ligand chemokine, exodus-3, Macrophage in
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CCL19
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53052. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7181
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7181
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 7181
Common Name: TR2/NR2C1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NR2C1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50755. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7181
Common Name:
TR2/NR2C1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NR2C1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50755. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5609
Common Name: MKK7/MEK7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MAP2K7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50642. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5609
Common Name:
MKK7/MEK7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
c-Jun N-terminal kinase kinase 2, dual specificity mitogen-activated protein kinase kinase 7, EC 2.7.12.2, JNK kinase 2, JNK-activating kinase 2, JNKK 2, JNKK2, MAP kinase kinase 7, MAPK/ERK kinase 7, MAPKK7, MEK 7, MEK7, mitogen-activated protein kinase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MAP2K7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50642. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml