NBP256326PE
Novus Biologicals™ FAM110A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256326PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256326PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
83541
Common Name
FAM110A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
bA371L19.3, C20orf55, chromosome 20 open reading frame 55, F10, family with sequence similarity 110, member A, hypothetical protein LOC83541, MGC2450, MGC4675
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FAM110A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50789. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM110A
- Source: E.coli Amino Acid Sequence: MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE The FAM110A Recombinant Protein Antigen is derived from E
- coli
- The FAM110A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 83541
Common Name: FAM110A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: bA371L19.3, C20orf55, chromosome 20 open reading frame 55, F10, family with sequence similarity 110, member A, hypothetical protein LOC83541, MGC2450, MGC4675
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM110A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50789. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83541
Common Name:
FAM110A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
bA371L19.3, C20orf55, chromosome 20 open reading frame 55, F10, family with sequence similarity 110, member A, hypothetical protein LOC83541, MGC2450, MGC4675
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM110A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50789. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23481
Common Name: Pescadillo Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PES1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50714. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23481
Common Name:
Pescadillo Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
pescadillo homolog, pescadillo homolog 1, containing BRCT domain (zebrafish), PESpescadillo (zebrafish) homolog 1, containing BRCT domain
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PES1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50714. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 92856
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
92856
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 92856
Common Name: IMP4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: IMP4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52960. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
92856
Common Name:
IMP4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
IMP4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52960. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml