Novus Biologicals™ NEDD4L Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256344PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256344PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
23327
Common Name
NEDD4L Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
NEDD4L
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50643. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEDD4L
- Source: E.coli Amino Acid Sequence: DEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPP The NEDD4L Recombinant Protein Antigen is derived from E
- coli
- The NEDD4L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 23327
Common Name: NEDD4L Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: E3 ubiquitin-protein ligase NEDD4-like, EC 6.3.2, EC 6.3.2.-, FLJ33870, hNedd4-2, KIAA0439ubiquitin-protein ligase NEDD4-like, NEDD4.2, Nedd4-2, NEDL3, neural precursor cell expressed, developmentally down-regulated 4-like, neural precursor cell expressed
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NEDD4L
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50643. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1856
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dishevelled 2 (homologous to Drosophila dsh), dishevelled, dsh homolog 2 (Drosophila), Dishevelled-2, DSH homolog 2, segment polarity protein dishevelled homolog DVL-2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 90321
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: zinc finger protein 766
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __