NBP256361PE
Novus Biologicals™ FAM241A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256361PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256361PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
132720
Common Name
C4orf32 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
chromosome 4 open reading frame 32, FLJ39370
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
C4ORF32
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53146. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C4orf32
- Source: E.coli Amino Acid Sequence: GERDEDGDALAEREAAGTEWDPGASPRRRGQRPKESEQDVEDSQN The FAM241A Recombinant Protein Antigen is derived from E
- coli
- The FAM241A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 132720
Common Name: C4orf32 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: chromosome 4 open reading frame 32, FLJ39370
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: C4ORF32
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53146. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
132720
Common Name:
C4orf32 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
chromosome 4 open reading frame 32, FLJ39370
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
C4ORF32
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53146. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 64421
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: ASCID, DCLREC1C, DNA cross-link repair 1C, DNA cross-link repair 1C protein, EC 3.1, FLJ36438, hSNM1C, protein artemis, Protein A-SCID, PSO2 homolog, RS-SCID, severe combined immunodeficiency, type a (Athabascan), SNM1 homolog C, SNM1CS. cerevisiae), SNM1-like protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
64421
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
ASCID, DCLREC1C, DNA cross-link repair 1C, DNA cross-link repair 1C protein, EC 3.1, FLJ36438, hSNM1C, protein artemis, Protein A-SCID, PSO2 homolog, RS-SCID, severe combined immunodeficiency, type a (Athabascan), SNM1 homolog C, SNM1CS. cerevisiae), SNM1-like protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8893
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8893
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initiation factor eIF-2B subunit epsilon
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8893
Common Name: eIF2B epsilon Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initi
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EIF2B5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53148. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8893
Common Name:
eIF2B epsilon Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CACH, CLE, EIF-2B, eIF-2B GDP-GTP exchange factor subunit epsilon, EIF2BE, EIF2Bepsilon, eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD), eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa, LVWM, translation initi
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EIF2B5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53148. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml