NBP256392PE
Novus Biologicals™ CPEB2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256392PE-Each-of-1 | In Stock | ₹ 26,095.80 |
NBP256392PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 26,095.80
GST (18%): ₹ 4,697.244
Total Price: ₹ 30,793.044
Gene ID (Entrez)
132864
Common Name
CPEB2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CPEB2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
Human
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CPEB2
- Source: E.coli Amino Acid Sequence: NTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHS The CPEB2 Recombinant Protein Antigen is derived from E
- coli
- The CPEB2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 132864
Common Name: CPEB2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CPEB2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: Human
Gene ID (Entrez):
132864
Common Name:
CPEB2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CPEB2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
Human
Gene ID (Entrez): 8089
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8089
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8089
Common Name: GAS41 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: YEATS4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53362. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8089
Common Name:
GAS41 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
YEATS4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53362. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 28978
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6orf73PTD011, transmembrane protein 14A
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
28978
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C6orf73PTD011, transmembrane protein 14A
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__