NBP256404PE
Novus Biologicals™ PHLDA1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256404PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256404PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
22822
Common Name
PHLDA1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich p
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PHLDA1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52676. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHLDA1
- Source: E.coli Amino Acid Sequence: KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP The PHLDA1 Recombinant Protein Antigen is derived from E
- coli
- The PHLDA1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 22822
Common Name: PHLDA1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich p
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PHLDA1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52676. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
22822
Common Name:
PHLDA1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich p
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PHLDA1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52676. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 283870
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BRICHOS domain-containing protein C16orf79, C16orf79, chromosome 16 open reading frame 79, MGC21830
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
283870
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BRICHOS domain-containing protein C16orf79, C16orf79, chromosome 16 open reading frame 79, MGC21830
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 253782
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CerS6, LAG1 homolog, ceramide synthase 6, LAG1 longevity assurance homolog 6, LAG1 longevity assurance homolog 6 (S. cerevisiae), longevity assurance homolog 6, MGC129949, MGC129950
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
253782
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CerS6, LAG1 homolog, ceramide synthase 6, LAG1 longevity assurance homolog 6, LAG1 longevity assurance homolog 6 (S. cerevisiae), longevity assurance homolog 6, MGC129949, MGC129950
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 253782
Common Name: LASS6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CerS6, LAG1 homolog, ceramide synthase 6, LAG1 longevity assurance homolog 6, LAG1 longevity assurance homolog 6 (S. cerevisiae), longevity assurance homolog 6, MGC129949, MGC129950
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CERS6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52677. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
253782
Common Name:
LASS6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CerS6, LAG1 homolog, ceramide synthase 6, LAG1 longevity assurance homolog 6, LAG1 longevity assurance homolog 6 (S. cerevisiae), longevity assurance homolog 6, MGC129949, MGC129950
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CERS6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52677. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml