Novus Biologicals™ RIMS2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256512PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256512PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
9699
Common Name
RIMS2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3I
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RIMS2
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52949. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIMS2
- Source: E.coli Amino Acid Sequence: MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS The RIMS2 Recombinant Protein Antigen is derived from E
- coli
- The RIMS2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9699
Common Name: RIMS2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp781A0653, KIAA0751RIM2OBOERAB3 interacting protein 3, non-small cell lung cancer RimL3a protein, non-small cell lung cancer RimL3c protein, nuclear protein, rab3-interacting molecule 2, Rab-3-interacting molecule 2, Rab-3-interacting protein 3, RAB3I
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RIMS2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52949. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6755
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: somatostatin receptor 5, somatostatin receptor subtype 5, somatostatin receptor type 5, SS5R, SS-5-R, SS5-R
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 6755
Common Name: Somatostatin R5/SSTR5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: somatostatin receptor 5, somatostatin receptor subtype 5, somatostatin receptor type 5, SS5R, SS-5-R, SS5-R
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SSTR5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52950. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
