NBP256536PE
Novus Biologicals™ STAMP2/STEAP4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256536PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256536PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
79689
Common Name
STAMP2/STEAP4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 1.16.1, EC 1.16.1.-, FLJ23153, Six-transmembrane epithelial antigen of prostate 4, SixTransMembrane protein of prostate 2, STAMP2DKFZp666D049, STEAP family member 4, TIARPsix transmembrane prostate protein 2, TNFAIP9, Tumor necrosis factor, alpha-induc
Label Type
Unlabeled
Quantity
100μL
Research Category
Cancer
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53549. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
STEAP4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAMP2/STEAP4
- Source: E.coli Amino Acid Sequence: IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD The STAMP2/STEAP4 Recombinant Protein Antigen is derived from E
- coli
- The STAMP2/STEAP4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 79689
Common Name: STAMP2/STEAP4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 1.16.1, EC 1.16.1.-, FLJ23153, Six-transmembrane epithelial antigen of prostate 4, SixTransMembrane protein of prostate 2, STAMP2DKFZp666D049, STEAP family member 4, TIARPsix transmembrane prostate protein 2, TNFAIP9, Tumor necrosis factor, alpha-induc
Label Type: Unlabeled
Quantity: 100μL
Research Category: Cancer
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53549. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: STEAP4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
79689
Common Name:
STAMP2/STEAP4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 1.16.1, EC 1.16.1.-, FLJ23153, Six-transmembrane epithelial antigen of prostate 4, SixTransMembrane protein of prostate 2, STAMP2DKFZp666D049, STEAP family member 4, TIARPsix transmembrane prostate protein 2, TNFAIP9, Tumor necrosis factor, alpha-induc
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Cancer
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53549. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
STEAP4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 3218
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: homeo box 2D, homeo box B8, homeobox B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D, homeobox protein Hox-B8, HOX2, HOX2DHox-2.4
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
3218
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
homeo box 2D, homeo box B8, homeobox B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D, homeobox protein Hox-B8, HOX2, HOX2DHox-2.4
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 3218
Common Name: HOXB8 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: homeo box 2D, homeo box B8, homeobox B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D, homeobox protein Hox-B8, HOX2, HOX2DHox-2.4
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: HOXB8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
3218
Common Name:
HOXB8 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
homeo box 2D, homeo box B8, homeobox B8, Homeobox protein Hox-2.4, Homeobox protein Hox-2D, homeobox protein Hox-B8, HOX2, HOX2DHox-2.4
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
HOXB8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 9993
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
9993
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__