NBP256570PE
Novus Biologicals™ STRIP1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256570PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP256570PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
85369
Common Name
STRIP1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Prot
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FAM40A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50450. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STRIP1
- Source: E.coli Amino Acid Sequence: DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE The STRIP1 Recombinant Protein Antigen is derived from E
- coli
- The STRIP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 85369
Common Name: STRIP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Prot
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM40A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50450. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
85369
Common Name:
STRIP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FAM40A, Family With Sequence Similarity 40, Member A, FAR11 Factor Arrest 11 Homolog A, FAR11 Factor Arrest 11 Homolog A (Yeast), FAR11A, Homolog Of Yeast FAR11 Protein 1, KIAA1761, Protein FAM40A, Striatin Interacting Protein 1, Striatin-Interacting Prot
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM40A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50450. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6660
Common Name: SOX5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: L-SOX5, MGC35153, SRY (sex determining region Y)-box 5, transcription factor SOX-5
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SOX5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50451. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6660
Common Name:
SOX5 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
L-SOX5, MGC35153, SRY (sex determining region Y)-box 5, transcription factor SOX-5
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SOX5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50451. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 201158
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: family with sequence similarity 18, member B2, hypothetical protein LOC201158, MGC8763
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
201158
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
family with sequence similarity 18, member B2, hypothetical protein LOC201158, MGC8763
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 201158
Common Name: FAM18B2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: family with sequence similarity 18, member B2, hypothetical protein LOC201158, MGC8763
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TVP23C
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50987. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
201158
Common Name:
FAM18B2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
family with sequence similarity 18, member B2, hypothetical protein LOC201158, MGC8763
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TVP23C
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50987. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml