NBP256636PE
Novus Biologicals™ RDH5 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256636PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256636PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
5959
Common Name
RDH5 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RDH5
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RDH5
- Source: E.coli Amino Acid Sequence: NNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALL The RDH5 Recombinant Protein Antigen is derived from E
- coli
- The RDH5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5959
Common Name: RDH5 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RDH5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5959
Common Name:
RDH5 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
11-cis RDH, 11-cis retinol dehydrogenase, 9,9-cis-retinol specific dehydrogenase, EC 1.1.1, EC 1.1.1.105, FLJ39337, FLJ97089, HSD17B, RDH1, retinol dehydrogenase 1, retinol dehydrogenase 5 (11-cis and 9-cis), retinol dehydrogenase 5 (11-cis/9-cis), SDR9C5
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RDH5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52662. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 375190
Common Name: LOC375190 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: family with sequence similarity 228, member B, hypothetical protein LOC375190
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FAM228B
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52663. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
375190
Common Name:
LOC375190 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
family with sequence similarity 228, member B, hypothetical protein LOC375190
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FAM228B
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52663. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7781
Common Name: SLC30A3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: solute carrier family 30 (zinc transporter), member 3, Solute carrier family 30 member 3, zinc transporter 3, znT-3, ZNT3zinc transporter ZnT-3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC30A3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53043. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7781
Common Name:
SLC30A3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
solute carrier family 30 (zinc transporter), member 3, Solute carrier family 30 member 3, zinc transporter 3, znT-3, ZNT3zinc transporter ZnT-3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC30A3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53043. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 84444
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DOT1-like protein, DOT1-like, histone H3 methyltransferase (S. cerevisiae), EC 2.1.1.43, H3-K79-HMTase, KIAA1814DKFZp586P1823, KMT4H3 lysine-79 specific, Lysine N-methyltransferase 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84444
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DOT1-like protein, DOT1-like, histone H3 methyltransferase (S. cerevisiae), EC 2.1.1.43, H3-K79-HMTase, KIAA1814DKFZp586P1823, KMT4H3 lysine-79 specific, Lysine N-methyltransferase 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__