NBP256664PE
Novus Biologicals™ EPS15R Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256664PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256664PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
58513
Common Name
EPS15R Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
epidermal growth factor receptor pathway substrate 15-like 1, epidermal growth factor receptor substrate 15-like 1, epidermal growth factor receptor substrate EPS15R, EPS15R, Eps15-related protein
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
EPS15L1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52011. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EPS15R
- Source: E.coli Amino Acid Sequence: PVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDPFVPSSAAKPSKASASGFADFTS The EPS15R Recombinant Protein Antigen is derived from E
- coli
- The EPS15R Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 58513
Common Name: EPS15R Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: epidermal growth factor receptor pathway substrate 15-like 1, epidermal growth factor receptor substrate 15-like 1, epidermal growth factor receptor substrate EPS15R, EPS15R, Eps15-related protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EPS15L1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52011. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
58513
Common Name:
EPS15R Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
epidermal growth factor receptor pathway substrate 15-like 1, epidermal growth factor receptor substrate 15-like 1, epidermal growth factor receptor substrate EPS15R, EPS15R, Eps15-related protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EPS15L1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52011. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8833
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8833
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8833
Common Name: GMPS Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GMPS
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8833
Common Name:
GMPS Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GMPS
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 145270
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Protein Phosphatase 1 Regulatory Subunit 3E, Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 3E, Protein Phosphatase 1, Regulatory Subunit 3E
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
145270
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Protein Phosphatase 1 Regulatory Subunit 3E, Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 3E, Protein Phosphatase 1, Regulatory Subunit 3E
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__