NBP256744PE
Novus Biologicals™ Pyruvate Dehydrogenase E2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256744PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP256744PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
1737
Common Name
Pyruvate Dehydrogenase E2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
DLAT
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50540. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pyruvate Dehydrogenase E2
- Source: E.coli Amino Acid Sequence: LAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLE The Pyruvate Dehydrogenase E2 Recombinant Protein Antigen is derived from E
- coli
- The Pyruvate Dehydrogenase E2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 1737
Common Name: Pyruvate Dehydrogenase E2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: DLAT
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50540. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1737
Common Name:
Pyruvate Dehydrogenase E2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
70 kDa mitochondrial autoantigen of primary biliary cirrhosis, dihydrolipoamide S-acetyltransferase, DLTA, E2 component of pyruvate dehydrogenase complex, EC 2.3.1, M2 antigen complex 70 kDa subunit, PBC, PDC-E2EC 2.3.1.12, PDCE2mitochondrial
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
DLAT
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50540. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 51192
Common Name: Chemokine-like factor Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C32CKLF2, chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, CKLF1, CKLF3, CKLF4, HSPC224, transmembrane proteolipid, UCK-1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CKLF
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52623. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
51192
Common Name:
Chemokine-like factor Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C32CKLF2, chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, CKLF1, CKLF3, CKLF4, HSPC224, transmembrane proteolipid, UCK-1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CKLF
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52623. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 92591
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Ankyrin Repeat And SOCS Box Containing 16, Ankyrin Repeat And SOCS Box-Containing 16, ASB-16
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
92591
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Ankyrin Repeat And SOCS Box Containing 16, Ankyrin Repeat And SOCS Box-Containing 16, ASB-16
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 57149
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: A211C6.1, LYR motif containing 1, LYR motif-containing protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57149
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
A211C6.1, LYR motif containing 1, LYR motif-containing protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__