NBP256768PE
Novus Biologicals™ CHRAC1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256768PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256768PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
54108
Common Name
CHRAC1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CHRAC1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52321. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHRAC1
- Source: E.coli Amino Acid Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCL The CHRAC1 Recombinant Protein Antigen is derived from E
- coli
- The CHRAC1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 54108
Common Name: CHRAC1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CHRAC1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52321. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
54108
Common Name:
CHRAC1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CHARC1, CHRAC-1, CHRAC-15, CHRAC15CHARC15, chromatin accessibility complex 1, Chromatin accessibility complex 15 kDa protein, DNA polymerase epsilon subunit p15, histone-fold protein CHRAC15, HuCHRAC15, YCL1chromatin accessibility complex protein 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CHRAC1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52321. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8819
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: 30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kDa
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8819
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kDa
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8819
Common Name: SAP30 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kD
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SAP30
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52322. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8819
Common Name:
SAP30 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
30 kDa Sin3-associated polypeptide, histone deacetylase complex subunit SAP30, Sin3 corepressor complex subunit SAP30, Sin3A-associated protein, 30kDa, Sin3-associated polypeptide p30, sin3-associated polypeptide, 30 kDa, Sin3-associated polypeptide, 30kD
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SAP30
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52322. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3397
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding 1, inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
3397
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
BHLHB24, bHLHb24DNA-binding protein inhibitor ID-1, Class B basic helix-loop-helix protein 24, dJ857M17.1.2, dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helixprotein), ID, inhibitor of differentiation 1, Inhibitor of DNA binding 1, inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__