NBP256818PE
Novus Biologicals™ TRAILR1/TNFRSF10A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256818PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256818PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8797
Common Name
TRAILR1/TNFRSF10A
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis facto
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
TNFRSF10A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51707. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAIL R1/TNFRSF10A
- Source: E.coli Amino Acid Sequence: ATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSA The TRAILR1/TNFRSF10A Recombinant Protein Antigen is derived from E
- coli
- The TRAILR1/TNFRSF10A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8797
Common Name: TRAILR1/TNFRSF10A
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis facto
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TNFRSF10A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51707. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8797
Common Name:
TRAILR1/TNFRSF10A
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
APO2, CD261, CD261 antigen, cytotoxic TRAIL receptor, Death receptor 4, DR4, DR4 TRAIL receptor 1, TNF-related apoptosis inducing ligand receptor 1, TNF-related apoptosis-inducing ligand receptor 1, TRAIL-R1, TRAILR-1, TRAILR1MGC9365, tumor necrosis facto
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TNFRSF10A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51707. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9555
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9555
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
core histone macro-H2A.1, H2A histone family, member Y, H2A.y, H2A/y, H2AF12M, H2AFJ, Histone H2A.y, Histone macroH2A1, histone macroH2A1.1, histone macroH2A1.2, MACROH2A1, MACROH2A1.1, macroH2A1.2, Medulloblastoma antigen MU-MB-50.205, mH2A1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1936
Common Name: EEF1D Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Antigen NY-CO-4, EF-1D, EF-1-delta, EF1DFP1047, elongation factor 1-delta, eukaryotic translation elongation factor 1 delta (guanine nucleotide exchangeprotein), FLJ20897, guanine nucleotide exchange protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EEF1D
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50190. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1936
Common Name:
EEF1D Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Antigen NY-CO-4, EF-1D, EF-1-delta, EF1DFP1047, elongation factor 1-delta, eukaryotic translation elongation factor 1 delta (guanine nucleotide exchangeprotein), FLJ20897, guanine nucleotide exchange protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EEF1D
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50190. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 57082
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AF15Q14, Blinkin, blinkin, bub-linking kinetochore protein, Bub-linking kinetochore protein, cancer susceptibility candidate 5, Cancer susceptibility candidate gene 5 protein, Cancer/testis antigen 29, CT29KIAA1570, D40, hKNL-1, hSpc105, kinetochore null
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
57082
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AF15Q14, Blinkin, blinkin, bub-linking kinetochore protein, Bub-linking kinetochore protein, cancer susceptibility candidate 5, Cancer susceptibility candidate gene 5 protein, Cancer/testis antigen 29, CT29KIAA1570, D40, hKNL-1, hSpc105, kinetochore null
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__