NBP256919PE
Novus Biologicals™ Breast cancer suppressor candidate 1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256919PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256919PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4013
Common Name
Breast cancer suppressor candidate 1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, ge
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
VWA5A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50489. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Breast cancer suppressor candidate 1
- Source: E.coli Amino Acid Sequence: FSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGM The Breast cancer suppressor candidate 1 Recombinant Protein Antigen is derived from E
- coli
- The Breast cancer suppressor candidate 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4013
Common Name: Breast cancer suppressor candidate 1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, ge
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: VWA5A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50489. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4013
Common Name:
Breast cancer suppressor candidate 1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
BCSC-1Loss of heterozygosity 11 chromosomal region 2 gene A protein, BCSC1ortholog of mouse AW551984, Breast cancer suppressor candidate 1, LOH11CR2Avon Willebrand factor A domain-containing protein 5A, loss of heterozygosity, 11, chromosomal region 2, ge
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
VWA5A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50489. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10403
Common Name: NDC80 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), hsHec1, hsNDC80, kinetochore associate
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NDC80
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50702. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10403
Common Name:
NDC80 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
HEC1KNTC2, HECRetinoblastoma-associated protein HEC, Highly expressed in cancer protein, highly expressed in cancer, rich in leucine heptad repeats, highly expressed in cancer, rich in leucine heptad repeats (yeast), hsHec1, hsNDC80, kinetochore associate
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NDC80
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50702. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7482
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Protein Wnt-13, protein Wnt-2b, wingless-type MMTV integration site family, member 2B, WNT13XWNT2, Xenopus, homolog of, XWNT2wingless-type MMTV integration site family, member 13
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
7482
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Protein Wnt-13, protein Wnt-2b, wingless-type MMTV integration site family, member 2B, WNT13XWNT2, Xenopus, homolog of, XWNT2wingless-type MMTV integration site family, member 13
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 4863
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4863
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__