NBP256973PE
Novus Biologicals™ Rab3D Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256973PE-Each-of-1 | In Stock | ₹ 29,004.84 |
NBP256973PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 29,004.84
GST (18%): ₹ 5,220.871
Total Price: ₹ 34,225.711
Gene ID (Entrez)
9545
Common Name
Rab3D Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
RAB3D
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50556. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Rab3D
- Source: E.coli Amino Acid Sequence: CEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC The Rab3D Recombinant Protein Antigen is derived from E
- coli
- The Rab3D Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 9545
Common Name: Rab3D Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RAB3D
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50556. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9545
Common Name:
Rab3D Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
D2-2, GOVras-related protein Rab-3D, RAB16glioblastoma overexpressed, RAB3D, member RAS oncogene family, RAD3DRab3D upregulated with myeloid differentiation
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RAB3D
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50556. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23187
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FLJ00141, LL5alpha, pleckstrin homology-like domain, family B, member 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23187
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FLJ00141, LL5alpha, pleckstrin homology-like domain, family B, member 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23187
Common Name: PHLDB1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FLJ00141, LL5alpha, pleckstrin homology-like domain, family B, member 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PHLDB1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52494. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23187
Common Name:
PHLDB1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FLJ00141, LL5alpha, pleckstrin homology-like domain, family B, member 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PHLDB1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52494. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 79671
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Caterpiller protein 11.3, CLR11.3DLNB26, MGC131937, MGC21025, NLR family member X1, NLR family, X1, NOD26, NOD5, NOD9FLJ21478, NOD-like receptor X1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, Nucleotide-binding oligomerization domain protein 9, nucleotide-binding oligomerization domain, leucine rich repeat containing X1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
79671
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Caterpiller protein 11.3, CLR11.3DLNB26, MGC131937, MGC21025, NLR family member X1, NLR family, X1, NOD26, NOD5, NOD9FLJ21478, NOD-like receptor X1, Nucleotide-binding oligomerization domain protein 26, Nucleotide-binding oligomerization domain protein 5, Nucleotide-binding oligomerization domain protein 9, nucleotide-binding oligomerization domain, leucine rich repeat containing X1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__