NBP257015PE
Novus Biologicals™ CD28 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257015PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257015PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
940
Common Name
CD28 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
CD28 antigen, CD28 antigen (Tp44), CD28 molecule, MGC138290, T-cell-specific surface glycoprotein CD28, Tp44
Label Type
Unlabeled
Quantity
100μL
Research Category
Adaptive Immunity, Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Neuroscience, Signal Transduction
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53194. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
CD28
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD28
- Source: E.coli Amino Acid Sequence: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS The CD28 Recombinant Protein Antigen is derived from E
- coli
- The CD28 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 940
Common Name: CD28 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CD28 antigen, CD28 antigen (Tp44), CD28 molecule, MGC138290, T-cell-specific surface glycoprotein CD28, Tp44
Label Type: Unlabeled
Quantity: 100μL
Research Category: Adaptive Immunity, Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Neuroscience, Signal Transduction
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53194. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CD28
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
940
Common Name:
CD28 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CD28 antigen, CD28 antigen (Tp44), CD28 molecule, MGC138290, T-cell-specific surface glycoprotein CD28, Tp44
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Adaptive Immunity, Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Neuroscience, Signal Transduction
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53194. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CD28
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 6813
Common Name: Syntaxin-BP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FHL5, Hunc18b, MUNC18-2, Protein unc-18 homolog 2, Protein unc-18 homolog B, syntaxin binding protein 2, syntaxin-binding protein 2, UNC18-2, Unc-18B, UNC18Bpp10122
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: STXBP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
6813
Common Name:
Syntaxin-BP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FHL5, Hunc18b, MUNC18-2, Protein unc-18 homolog 2, Protein unc-18 homolog B, syntaxin binding protein 2, syntaxin-binding protein 2, UNC18-2, Unc-18B, UNC18Bpp10122
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
STXBP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 10420
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: dual specificity testis-specific protein kinase 2, EC 2.7.12.1, Testicular protein kinase 2, testis-specific kinase 2
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
10420
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
dual specificity testis-specific protein kinase 2, EC 2.7.12.1, Testicular protein kinase 2, testis-specific kinase 2
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 3720
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: JMJjumonji-like protein, jumonji (mouse) homolog, jumonji homolog, jumonji, AT rich interactive domain 2, Jumonji/ARID domain-containing protein 2, protein Jumonji
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
3720
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
JMJjumonji-like protein, jumonji (mouse) homolog, jumonji homolog, jumonji, AT rich interactive domain 2, Jumonji/ARID domain-containing protein 2, protein Jumonji
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__