NBP257041PE
Novus Biologicals™ SLC2A11 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257041PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257041PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
66035
Common Name
SLC2A11 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
facilitative glucose transporter GLUT11, glucose transporter protein 10, glucose transporter protein 11, GLUT10, GLUT-10, GLUT11, GLUT-11, SLC2A11-a, SLC2A11-c, solute carrier family 2 (facilitated glucose transporter), member 11, solute carrier family 2,
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SLC2A11
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC2A11
- Source: E.coli Amino Acid Sequence: KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL The SLC2A11 Recombinant Protein Antigen is derived from E
- coli
- The SLC2A11 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 66035
Common Name: SLC2A11 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: facilitative glucose transporter GLUT11, glucose transporter protein 10, glucose transporter protein 11, GLUT10, GLUT-10, GLUT11, GLUT-11, SLC2A11-a, SLC2A11-c, solute carrier family 2 (facilitated glucose transporter), member 11, solute carrier family 2,
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SLC2A11
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
66035
Common Name:
SLC2A11 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
facilitative glucose transporter GLUT11, glucose transporter protein 10, glucose transporter protein 11, GLUT10, GLUT-10, GLUT11, GLUT-11, SLC2A11-a, SLC2A11-c, solute carrier family 2 (facilitated glucose transporter), member 11, solute carrier family 2,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SLC2A11
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5566
Common Name: PKA C alpha Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: cAMP-dependent protein kinase catalytic subunit alpha, EC 2.7.11, EC 2.7.11.11, MGC102831, MGC48865, PKA C-alpha, PKACA, protein kinase A catalytic subunit, protein kinase, cAMP-dependent, catalytic, alpha
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PRKACA
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5566
Common Name:
PKA C alpha Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
cAMP-dependent protein kinase catalytic subunit alpha, EC 2.7.11, EC 2.7.11.11, MGC102831, MGC48865, PKA C-alpha, PKACA, protein kinase A catalytic subunit, protein kinase, cAMP-dependent, catalytic, alpha
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PRKACA
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50852. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9542
Common Name: Neuregulin-2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: divergent of neuregulin-1, Don-1, DON1, HRG2, neuregulin 2, NTAKneural- and thymus-derived activator for ErbB kinases, pro-neuregulin-2, membrane-bound isoform, Pro-NRG2
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: NRG2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49882. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
9542
Common Name:
Neuregulin-2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
divergent of neuregulin-1, Don-1, DON1, HRG2, neuregulin 2, NTAKneural- and thymus-derived activator for ErbB kinases, pro-neuregulin-2, membrane-bound isoform, Pro-NRG2
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
NRG2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49882. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8792
Common Name: RANK/TNFRSF11A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CD265, CD265 antigen, FEO, loss of heterozygosity, 18, chromosomal region 1, ODFROSTS, OFE, OPTB7, Osteoclast differentiation factor receptor, PDB2, RANKLOH18CR1, Receptor activator of NF-KB, receptor activator of nuclear factor-kappa B, TRANCER, tumor ne
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TNFRSF11A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8792
Common Name:
RANK/TNFRSF11A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CD265, CD265 antigen, FEO, loss of heterozygosity, 18, chromosomal region 1, ODFROSTS, OFE, OPTB7, Osteoclast differentiation factor receptor, PDB2, RANKLOH18CR1, Receptor activator of NF-KB, receptor activator of nuclear factor-kappa B, TRANCER, tumor ne
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TNFRSF11A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml