NBP257065PE
Novus Biologicals™ LZIC Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257065PE-Each-of-1 | In Stock | ₹ 29,004.84 |
NBP257065PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 29,004.84
GST (18%): ₹ 5,220.871
Total Price: ₹ 34,225.711
Gene ID (Entrez)
84328
Common Name
LZIC Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
leucine zipper and CTNNBIP1 domain containing, Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing, MGC15436, protein LZIC
Label Type
Unlabeled
Quantity
100μL
Research Category
Neuroscience
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52285. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LZIC
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LZIC
- Source: E.coli Amino Acid Sequence: KTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRK The LZIC Recombinant Protein Antigen is derived from E
- coli
- The LZIC Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 84328
Common Name: LZIC Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: leucine zipper and CTNNBIP1 domain containing, Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing, MGC15436, protein LZIC
Label Type: Unlabeled
Quantity: 100μL
Research Category: Neuroscience
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52285. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LZIC
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
84328
Common Name:
LZIC Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
leucine zipper and CTNNBIP1 domain containing, Leucine zipper and CTNNBIP1 domain-containing protein, Leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing, MGC15436, protein LZIC
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Neuroscience
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52285. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LZIC
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 64122
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 2.7.1.-, fructosamine 3 kinase, fructosamine-3-kinase
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
64122
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 2.7.1.-, fructosamine 3 kinase, fructosamine-3-kinase
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 23210
Common Name: JMJD6/PSR Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, EC 1.14.11, EC 1.14.11.-, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, jumonji domain containing 6, Jumonji domain-containing protein 6, KIAA0585PSR, Lysyl-hydroxylase
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50417. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: JMJD6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
23210
Common Name:
JMJD6/PSR Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
bifunctional arginine demethylase and lysyl-hydroxylase JMJD6, EC 1.14.11, EC 1.14.11.-, Histone arginine demethylase JMJD6, JmjC domain-containing protein 6, jumonji domain containing 6, Jumonji domain-containing protein 6, KIAA0585PSR, Lysyl-hydroxylase
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50417. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
JMJD6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 85294
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: High sulfur keratin-associated protein 2.4, KAP2.4MGC119884, keratin associated protein 2-4, Keratin-associated protein 2.4, keratin-associated protein 2-4, KRTAP2.4, MGC119882, MGC119885, MGC74790
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
85294
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
High sulfur keratin-associated protein 2.4, KAP2.4MGC119884, keratin associated protein 2-4, Keratin-associated protein 2.4, keratin-associated protein 2-4, KRTAP2.4, MGC119882, MGC119885, MGC74790
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__