NBP257110PE
Novus Biologicals™ FERMT3/URP2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257110PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257110PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
83706
Common Name
FERMT3/URP2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FERMT3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FERMT3/URP2
- Source: E.coli Amino Acid Sequence: MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT The FERMT3/URP2 Recombinant Protein Antigen is derived from E
- coli
- The FERMT3/URP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 83706
Common Name: FERMT3/URP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FERMT3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
83706
Common Name:
FERMT3/URP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FERMT3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52856. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 93973
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Actin-Related Protein 8, ARP8, ARP8 (Actin-Related Protein 8, Yeast) Homolog, ARP8 Actin-Related Protein 8 Homolog, HArp8, INO80 Complex Subunit N, INO80N
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
93973
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Actin-Related Protein 8, ARP8, ARP8 (Actin-Related Protein 8, Yeast) Homolog, ARP8 Actin-Related Protein 8 Homolog, HArp8, INO80 Complex Subunit N, INO80N
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 93973
Common Name: ACTR8 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Actin-Related Protein 8, ARP8, ARP8 (Actin-Related Protein 8, Yeast) Homolog, ARP8 Actin-Related Protein 8 Homolog, HArp8, INO80 Complex Subunit N, INO80N
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ACTR8
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52857. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
93973
Common Name:
ACTR8 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Actin-Related Protein 8, ARP8, ARP8 (Actin-Related Protein 8, Yeast) Homolog, ARP8 Actin-Related Protein 8 Homolog, HArp8, INO80 Complex Subunit N, INO80N
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ACTR8
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52857. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54826
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: GIN-1gypsy integrase 1, gypsy retrotransposon integrase 1, TGIN1gypsy retrotransposon integrase-like protein 1, Ty3/Gypsy integrase 1, ZH2C2, Zinc finger H2C2 domain-containing protein, zinc finger, H2C2 domain containing
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54826
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
GIN-1gypsy integrase 1, gypsy retrotransposon integrase 1, TGIN1gypsy retrotransposon integrase-like protein 1, Ty3/Gypsy integrase 1, ZH2C2, Zinc finger H2C2 domain-containing protein, zinc finger, H2C2 domain containing
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__