NBP257126PE
Novus Biologicals™ HEMK2 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257126PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257126PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
29104
Common Name
HEMK2 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-
Label Type
Unlabeled
Quantity
100μL
Research Category
DNA replication Transcription Translation and Splicing
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52336. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
N6AMT1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEMK2
- Source: E.coli Amino Acid Sequence: GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT The HEMK2 Recombinant Protein Antigen is derived from E
- coli
- The HEMK2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 29104
Common Name: HEMK2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-
Label Type: Unlabeled
Quantity: 100μL
Research Category: DNA replication Transcription Translation and Splicing
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52336. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: N6AMT1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.coli
Gene ID (Entrez):
29104
Common Name:
HEMK2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, M.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
DNA replication Transcription Translation and Splicing
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52336. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
N6AMT1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.coli
Gene ID (Entrez): 602
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
602
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
B-cell CLL/lymphoma 3, B-cell leukemia/lymphoma 3, B-cell lymphoma 3 protein, B-cell lymphoma 3-encoded protein, BCL-3, BCL4, chronic lymphatic leukemia protein, D19S37, Proto-oncogene BCL3
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 9469
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C6ST-1, C6ST1HSD, C6STEC 2.8.2.17, carbohydrate (chondroitin 6) sulfotransferase 3, carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0, GST-0
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
9469
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C6ST-1, C6ST1HSD, C6STEC 2.8.2.17, carbohydrate (chondroitin 6) sulfotransferase 3, carbohydrate sulfotransferase 3, Chondroitin 6-O-sulfotransferase 1, Chondroitin 6-sulfotransferase, EC 2.8.2, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 0, GST-0
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 23478
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: EC 3.4, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SEC11 homolog A, SEC11 homolog A (S. cerevisiae), SEC11L1, SEC11-like 1, SEC11-like protein 1, sid2895, signal peptidase complex (18kD), signal peptidase complex catalytic subunit SEC11A, SPase 18 kDa subunit, SPC18SEC11-like 1 (S. cerevisiae), SPCS4A1810012E07Rik
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
23478
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
EC 3.4, Endopeptidase SP18, Microsomal signal peptidase 18 kDa subunit, SEC11 homolog A, SEC11 homolog A (S. cerevisiae), SEC11L1, SEC11-like 1, SEC11-like protein 1, sid2895, signal peptidase complex (18kD), signal peptidase complex catalytic subunit SEC11A, SPase 18 kDa subunit, SPC18SEC11-like 1 (S. cerevisiae), SPCS4A1810012E07Rik
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__