NBP257139PE
Novus Biologicals™ IDH3A Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257139PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257139PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
3419
Common Name
IDH3A Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alph
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
IDH3A
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IDH3A
- Source: E.coli Amino Acid Sequence: NKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTI The IDH3A Recombinant Protein Antigen is derived from E
- coli
- The IDH3A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 3419
Common Name: IDH3A Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alph
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: IDH3A
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3419
Common Name:
IDH3A Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 1.1.1, EC 1.1.1.41, H-IDH alpha, isocitrate dehydrogenase (NAD+) alpha chain, isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial, isocitrate dehydrogenase 3 (NAD+) alpha, Isocitric dehydrogenase subunit alpha, NAD(+)-specific ICDH subunit alph
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
IDH3A
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50547. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1555
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
1555
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 1555
Common Name: Cytochrome P450 2B6 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfa
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CYP2B6
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
1555
Common Name:
Cytochrome P450 2B6 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfa
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
CYP2B6
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52640. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23149
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FCH domain only 1, FCH domain only protein 1, KIAA0290
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23149
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FCH domain only 1, FCH domain only protein 1, KIAA0290
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__