NBP257186PE
Novus Biologicals™ Myosin light chain 3 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257186PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257186PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
4634
Common Name
Myosin light chain 3 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MYL3
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin light chain 3
- Source: E.coli Amino Acid Sequence: AKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIR The Myosin light chain 3 Recombinant Protein Antigen is derived from E
- coli
- The Myosin light chain 3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 4634
Common Name: Myosin light chain 3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MYL3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
4634
Common Name:
Myosin light chain 3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Cardiac myosin light chain 1, CMH8Ventricular/slow twitch myosin alkali light chain, CMLC1, light polypeptide 3, alkali; ventricular, skeletal, slow, MLC1SBMyosin light chain 1, slow-twitch muscle B/ventricular isoform, MLC1V, myosin light chain 3, myosin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MYL3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50550. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2322
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase 1, STK-1, STK1EC 2.7.10.1, Tyrosine-protein kinase receptor FLT3
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2322
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase 1, STK-1, STK1EC 2.7.10.1, Tyrosine-protein kinase receptor FLT3
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2322
Common Name: Flt-3/Flk-2/CD135 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FLT3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2322
Common Name:
Flt-3/Flk-2/CD135 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FLT3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 56851
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
56851
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__