Novus Biologicals™ ZDHHC21 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257201PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257201PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
340481
Common Name
ZDHHC21 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ZDHHC21
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52859. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZDHHC21
- Source: E.coli Amino Acid Sequence: RASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRM The ZDHHC21 Recombinant Protein Antigen is derived from E
- coli
- The ZDHHC21 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 340481
Common Name: ZDHHC21 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ZDHHC21
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52859. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 171024
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: synaptopodin-2, synaptopodin 2
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez): 63035
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: BCL6 corepressor-like 1, BCL-6 corepressor-like protein 1, BCoR-L1, BCoR-like protein 1, CXorf10, FLJ11362, FLJ11632
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __