Novus Biologicals™ Fyn Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257212PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257212PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
2534
Common Name
Fyn Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 2.7.10, EC 2.7.10.2, FYN oncogene related to SRC, FGR, YES, MGC45350, OKT3-induced calcium influx regulator, p59-Fyn, protein-tyrosine kinase fyn, Proto-oncogene c-Fyn, Proto-oncogene Syn, proto-oncogene tyrosine-protein kinase fyn, SLKc-syn protooncog
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
FYN
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50585. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fyn
- Source: E.coli Amino Acid Sequence: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE The Fyn Recombinant Protein Antigen is derived from E
- coli
- The Fyn Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 2534
Common Name: Fyn Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.7.10, EC 2.7.10.2, FYN oncogene related to SRC, FGR, YES, MGC45350, OKT3-induced calcium influx regulator, p59-Fyn, protein-tyrosine kinase fyn, Proto-oncogene c-Fyn, Proto-oncogene Syn, proto-oncogene tyrosine-protein kinase fyn, SLKc-syn protooncog
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FYN
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50585. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 1591
Common Name: CYP24A1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: 25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial, CP241, CYP241,25-alphadihydroxyvitamin D3 24-hydroxylase, Cytochrome P450 24A1, cytochrome P450, family 24, subfamily A, polypeptide 1,24-OHase, cytochrome P450, subfamily XXIV (vitamin D 24-hydroxyl
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: CYP24A1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50586. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 374739
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: TEPP testis, prostate and placenta expressed
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
