NBP257225PE
Novus Biologicals™ SERPINB13 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257225PE-Each-of-1 | In Stock | ₹ 31,372.50 |
NBP257225PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 31,372.50
GST (18%): ₹ 5,647.05
Total Price: ₹ 37,019.55
Gene ID (Entrez)
5275
Common Name
SERPINB13 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
SERPINB13
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51786. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SERPINB13
- Source: E.coli Amino Acid Sequence: RGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLF The SERPINB13 Recombinant Protein Antigen is derived from E
- coli
- The SERPINB13 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 5275
Common Name: SERPINB13 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SERPINB13
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51786. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5275
Common Name:
SERPINB13 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
HaCaT UV-repressible serpin, Headpin, HSHUR7SEQ, HUR7, HURPIN, MGC126870, Peptidase inhibitor 13, PI-13, PI13hurpin, protease inhibitor 13 (hurpin, headpin), Proteinase inhibitor 13, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SERPINB13
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51786. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 56672
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AKIP1koyt binding protein 2, BCA3koyt binding protein 3, breast cancer associated gene 3, Breast cancer-associated gene 3 protein, chromosome 11 open reading frame 17, koyt binding protein 1, PKA-interacting protein, proline-rich protein BCA3, protein kinase A-interacting protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
56672
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AKIP1koyt binding protein 2, BCA3koyt binding protein 3, breast cancer associated gene 3, Breast cancer-associated gene 3 protein, chromosome 11 open reading frame 17, koyt binding protein 1, PKA-interacting protein, proline-rich protein BCA3, protein kinase A-interacting protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 56672
Common Name: BCA3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AKIP1koyt binding protein 2, BCA3koyt binding protein 3, breast cancer associated gene 3, Breast cancer-associated gene 3 protein, chromosome 11 open reading frame 17, koyt binding protein 1, PKA-interacting protein, proline-rich protein BCA3, protein kin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: AKIP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52481. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
56672
Common Name:
BCA3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
AKIP1koyt binding protein 2, BCA3koyt binding protein 3, breast cancer associated gene 3, Breast cancer-associated gene 3 protein, chromosome 11 open reading frame 17, koyt binding protein 1, PKA-interacting protein, proline-rich protein BCA3, protein kin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
AKIP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52481. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 10579
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: anti zuai-1, AZU-1ECTACC, EC 2.4.2.10, EC 4.3.2.1, EC 6.3.5.2, transforming acidic coiled-coil-containing protein 2, transforming, acidic coiled-coil containing protein 2, Zuai-1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
10579
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
anti zuai-1, AZU-1ECTACC, EC 2.4.2.10, EC 4.3.2.1, EC 6.3.5.2, transforming acidic coiled-coil-containing protein 2, transforming, acidic coiled-coil containing protein 2, Zuai-1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__